PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619277.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 497aa    MW: 55099.3 Da    PI: 6.6724
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619277.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.2e-1775121148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEde l +av ++ g++Wk+Ia+ ++  Rt+ qc +rwqk+l
   XP_013619277.1  75 KGGWTPEEDETLRQAVCKFNGKSWKKIAEFFP-DRTEVQCLHRWQKVL 121
                      688*****************************.************986 PP

2Myb_DNA-binding56.94.6e-18127173148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT++Ede+++++v+++G+  W+ I+  ++ gR +kqc++rw+++l
   XP_013619277.1 127 KGPWTQQEDEKIIELVEKYGPAKWSIISDSLP-GRIGKQCRERWHNHL 173
                      79******************************.*************97 PP

3Myb_DNA-binding57.82.5e-18179222146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++WT+eE++ l +a++ +G++ W+ Ia+ ++ gRt++++k++w++
   XP_013619277.1 179 KDAWTPEEELALMNAHRVHGNK-WAEIAKVLP-GRTDNSIKNHWNS 222
                      679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.1670121IPR017930Myb domain
SuperFamilySSF466891.36E-1672130IPR009057Homeodomain-like
SMARTSM007177.3E-1474123IPR001005SANT/Myb domain
PfamPF002491.9E-1575121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2277133IPR009057Homeodomain-like
CDDcd001671.02E-1278121No hitNo description
PROSITE profilePS5129431.304122177IPR017930Myb domain
SuperFamilySSF466894.87E-32124220IPR009057Homeodomain-like
SMARTSM007172.6E-17126175IPR001005SANT/Myb domain
PfamPF002493.8E-17127173IPR001005SANT/Myb domain
CDDcd001671.38E-14129173No hitNo description
Gene3DG3DSA:1.10.10.603.1E-26134180IPR009057Homeodomain-like
SMARTSM007176.8E-17178226IPR001005SANT/Myb domain
PROSITE profilePS5129422.885178228IPR017930Myb domain
PfamPF002491.1E-16179222IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-23181227IPR009057Homeodomain-like
CDDcd001675.59E-13181224No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MSCDLNPPAS PPDEEVKMED ECVENKQSRA AASCSSVSEG SGGSSSFLKS PPAVASPPTA  60
SPTHRRTSGP IRRAKGGWTP EEDETLRQAV CKFNGKSWKK IAEFFPDRTE VQCLHRWQKV  120
LNPDLIKGPW TQQEDEKIIE LVEKYGPAKW SIISDSLPGR IGKQCRERWH NHLNPGINKD  180
AWTPEEELAL MNAHRVHGNK WAEIAKVLPG RTDNSIKNHW NSSLKKKSEF LLVNGSLPPA  240
AATNGVPSCF QRRVSVSVAQ TSCGTTQMNK PGEEGKDQLN SEAAAASPMA GFEEYVRSSQ  300
LPKPEPSPEN GCHLNNKKPQ PEDHHMASEA DKQRMYGYEC GCSPSASSPV IFFTPPPPSR  360
EEYSSNGSAP RSPESFLREA ARTFPNTPSI FRKRRRKVVV VPDNNKTDEE EAKKEVVDEK  420
VNGISETPDC EEKENSGSNA YNVSPPYRIR SKRTAVFKSR QLEFISPEED KVDDETKSSE  480
KDKLLDGGDS QLSGQEN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-66742275158MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-66742275158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1391395RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2141171e-161AF214117.2 Arabidopsis thaliana putative c-myb-like transcription factor (MYB3R3) mRNA, complete cds.
GenBankAY1426491e-161AY142649.1 Arabidopsis thaliana putative MYB family transcription factor (At3g09370) mRNA, complete cds.
GenBankAY5196511e-161AY519651.1 Arabidopsis thaliana MYB transcription factor (At3g09370) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619277.10.0PREDICTED: myb protein-like
TrEMBLA0A0D3AEW80.0A0A0D3AEW8_BRAOL; Uncharacterized protein (Fragment)
STRINGBra034067.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.10.0myb domain protein 3r-3